PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01609.1_g00009.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 361aa    MW: 40844.8 Da    PI: 7.4981
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01609.1_g00009.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.84.5e-171468148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT.......TTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg.......kgRtlkqcksrwqkyl 48
                             rg W++eEde+l+++++ +G g+W++++++ g       + R++k+c++rw +yl
  Rsa1.0_01609.1_g00009.1 14 RGLWSPEEDEKLINYINTYGHGCWSSVPKHAGiyigfvcLQRCGKSCRLRWINYL 68
                             788**************************************************97 PP

2Myb_DNA-binding48.42.2e-1574116145
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                              rg+++++E  l+++++  lG++ W+ Ia++++ gRt++++k++w+
  Rsa1.0_01609.1_g00009.1  74 RGSFSPQEAALIIELHSILGNR-WAQIAKHLP-GRTDNEVKNFWN 116
                              899*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.2E-26671IPR009057Homeodomain-like
PROSITE profilePS5129416.467968IPR017930Myb domain
SuperFamilySSF466892.41E-2811115IPR009057Homeodomain-like
SMARTSM007172.6E-131370IPR001005SANT/Myb domain
PfamPF002497.1E-161468IPR001005SANT/Myb domain
CDDcd001677.28E-121768No hitNo description
PROSITE profilePS5129425.20969123IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.6E-2572123IPR009057Homeodomain-like
SMARTSM007171.5E-1573121IPR001005SANT/Myb domain
PfamPF002493.4E-1474117IPR001005SANT/Myb domain
CDDcd001672.79E-1176116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MGHHSCCNKQ KVKRGLWSPE EDEKLINYIN TYGHGCWSSV PKHAGIYIGF VCLQRCGKSC  60
RLRWINYLRP DLKRGSFSPQ EAALIIELHS ILGNRWAQIA KHLPGRTDNE VKNFWNSSIK  120
KKLMSHHYHH HHGHHHHHTS SMASLLTNLP YHNVFNATAG DDEGSRFMSS IITNTNPNFI  180
TPTHLPLPSH HVMSPLMFST SREGDIKYLT ATNTNQSHQD NNLYTNLDIL SATPFINNHH  240
HHHDNDPQWP SLPDLPASTI STFHDNLQDY DDGDKLNVFV TPYNDNGDPR SFPLVATKLI  300
CGQVLEGKAI SQDHGSFLLP TTYNLEMPGD HRRVDSYINH MIIPSSSSSS SPISCGQYVI  360
T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-31141237108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1759970.0AF175997.1 Arabidopsis thaliana putative transcription factor (MYB26) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013676587.10.0PREDICTED: transcription factor MYB26-like isoform X1
SwissprotQ9SPG31e-178MYB26_ARATH; Transcription factor MYB26
TrEMBLM4DYB90.0M4DYB9_BRARP; Uncharacterized protein
STRINGBra021515.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM128031930
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13890.11e-160myb domain protein 26